Structure of PDB 7lj0 Chain B Binding Site BS01

Receptor Information
>7lj0 Chain B (length=145) Species: 35688 (Porphyridium purpureum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DGNKRLDAVNSIVSNASCMVSDAVSGMICENPGLISPGGNCYTNRRMAAC
LRDGEIILRYVSYALLAGDASVLEDRCLNGLKETYIALGVPTNSSIRAVS
IMKAQAVAFITNTATERKMSFAAGDCTSLASEVASYFDRVGAAIS
Ligand information
>7lj0 Chain A (length=27) Species: 35688 (Porphyridium purpureum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VNPRAGVRVRIKVVDNLYQVYEIPPMA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lj0 Scaffolding proteins guide the evolution of algal light harvesting antennas.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		E87 I88 R91 Y92 Y95 R108
Binding residue
(residue number reindexed from 1)		E55 I56 R59 Y60 Y63 R76
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane
GO:0030089 phycobilisome

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7lj0, PDBe:7lj0, PDBj:7lj0
PDBsum7lj0
PubMed33767155
UniProtP11393|PHEB_PORPP B-phycoerythrin beta chain (Gene Name=cpeB)

[Back to BioLiP]