Structure of PDB 7lio Chain B Binding Site BS01

Receptor Information
>7lio Chain B (length=136) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDE
ESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMEDQRAYRFVQG
KDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lio ATM-phosphorylated SPOP contributes to 53BP1 exclusion from chromatin during DNA replication.
Resolution3.01 Å
Binding residue
(original residue number in PDB)
D119 Y123 D130 W131 G132 F133
Binding residue
(residue number reindexed from 1)
D91 Y95 D102 W103 G104 F105
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7lio, PDBe:7lio, PDBj:7lio
PDBsum7lio
PubMed34144977
UniProtO43791|SPOP_HUMAN Speckle-type POZ protein (Gene Name=SPOP)

[Back to BioLiP]