Structure of PDB 7l4v Chain B Binding Site BS01

Receptor Information
>7l4v Chain B (length=69) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKV
EQLSRELSTLRNLFKQLPE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7l4v Preferential CEBP binding to T:G mismatches and increased C-to-T human somatic mutations.
Resolution1.75 Å
Binding residue
(original residue number in PDB)
K269 Y274 R278 N282 R289
Binding residue
(residue number reindexed from 1)
K2 Y7 R11 N15 R22
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:7l4v, PDBe:7l4v, PDBj:7l4v
PDBsum7l4v
PubMed33877329
UniProtP17676|CEBPB_HUMAN CCAAT/enhancer-binding protein beta (Gene Name=CEBPB)

[Back to BioLiP]