Structure of PDB 7kuf Chain B Binding Site BS01

Receptor Information
>7kuf Chain B (length=85) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LLQDQLQSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIR
QIESKTMSKLRHPSRSQVLRDGTPEERLLRAIFGE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kuf Structural insights into the functional divergence of WhiB-like proteins in Mycobacterium tuberculosis.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R470 V498 T499 E501 R502 Q505
Binding residue
(residue number reindexed from 1)		R16 V44 T45 E47 R48 Q51
Enzymatic activity
Enzyme Commision number 2.7.7.6: DNA-directed RNA polymerase.
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7kuf, PDBe:7kuf, PDBj:7kuf
PDBsum7kuf
PubMed34171298
UniProtP9WGI1|SIGA_MYCTU RNA polymerase sigma factor SigA (Gene Name=sigA);
P9WGY9|RPOB_MYCTU DNA-directed RNA polymerase subunit beta (Gene Name=rpoB)

[Back to BioLiP]