Structure of PDB 7klz Chain B Binding Site BS01

Receptor Information
>7klz Chain B (length=139) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGL
DEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFV
QGKDWGFKKFIRRGFLLDEANGLLPDDKLTLFCEVSVVQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7klz SPOP mutation induces replication over-firing by impairing Geminin ubiquitination and triggers replication catastrophe upon ATR inhibition.
Resolution3.4 Å
Binding residue
(original residue number in PDB)
Y123 D130 W131 G132 F133
Binding residue
(residue number reindexed from 1)
Y97 D104 W105 G106 F107
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7klz, PDBe:7klz, PDBj:7klz
PDBsum7klz
PubMed34599168
UniProtO43791|SPOP_HUMAN Speckle-type POZ protein (Gene Name=SPOP)

[Back to BioLiP]