Structure of PDB 7kld Chain B Binding Site BS01

Receptor Information
>7kld Chain B (length=106) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MITVDITVNDEGKVTDVIMDGHADHGEYGHDIVCAGASAVLFGSVNAIIG
LTSERPDINYDDNGGHFHIRSVDTNNDEAQLILQTMLVSLQTIEEEYNEN
IRLNYK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kld Phage-Related Ribosomal Protease (Prp) of Staphylococcus aureus : In Vitro Michaelis-Menten Kinetics, Screening for Inhibitors, and Crystal Structure of a Covalent Inhibition Product Complex.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		I2 H22 A23 G29 D31 C34 A35 S38 A39 F42 G65
Binding residue
(residue number reindexed from 1)		I2 H22 A23 G29 D31 C34 A35 S38 A39 F42 G65
Enzymatic activity
Enzyme Commision number 3.4.22.-
Gene Ontology
Molecular Function
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis
GO:0042254 ribosome biogenesis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7kld, PDBe:7kld, PDBj:7kld
PDBsum7kld
PubMed35731716
UniProtQ2FXS9|PRP_STAA8 Ribosomal processing cysteine protease Prp (Gene Name=prp)

[Back to BioLiP]