Structure of PDB 7kei Chain B Binding Site BS01

Receptor Information
>7kei Chain B (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSPEDFVFQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVT
PQGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRVEPTVTI
SPSNLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILV
MLEMTPQRGDVYTCHVEHPSLQSPITVEWR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kei Crystal structure of DQA1*01:02/DQB1*06:02 in complex with a flu peptide.
Resolution1.75 Å
Binding residue
(original residue number in PDB)		F11 Y30 D57 Y60 W61 E74 V78 H81 N82
Binding residue
(residue number reindexed from 1)		F10 Y29 D56 Y59 W60 E73 V77 H80 N81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7kei, PDBe:7kei, PDBj:7kei
PDBsum7kei
PubMed
UniProtQ5SU54

[Back to BioLiP]