Structure of PDB 7kd6 Chain B Binding Site BS01

Receptor Information
>7kd6 Chain B (length=49) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFPRRGIVEQCCHSICSLEQLENYCN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kd6 Single-chain insulin analogs threaded by the insulin receptor alpha CT domain.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
G8 V12 F24 F25 R35 G37 I38 V39 E40 E53 N54 Y55 C56
Binding residue
(residue number reindexed from 1)
G8 V12 F24 F25 R27 G29 I30 V31 E32 E45 N46 Y47 C48
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:7kd6, PDBe:7kd6, PDBj:7kd6
PDBsum7kd6
PubMed36181268
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]