Structure of PDB 7jvs Chain B Binding Site BS01

Receptor Information
>7jvs Chain B (length=106) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MITVDITVNDEGKVTDVIMDGHADHGEYGHDIVSAGASAVLFGSVNAIIG
LTSERPDINYDDQGGHFHIRSVDTNNDEAQLILQTMLVSLQTIEEEYNEN
IRLNYK
Ligand information
>7jvs Chain C (length=11) Species: 1280 (Staphylococcus aureus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KLNLQFFASKK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7jvs Crystal Structure of an Essential Ribosomal Processing Protease Prp from S. aureus in complex with a Substrate Peptide
Resolution2.3 Å
Binding residue
(original residue number in PDB)		H22 Y28 G29 D31 S34 A35 S38 F42 D61 G64
Binding residue
(residue number reindexed from 1)		H22 Y28 G29 D31 S34 A35 S38 F42 D61 G64
Enzymatic activity
Enzyme Commision number 3.4.22.-
Gene Ontology
Molecular Function
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis
GO:0042254 ribosome biogenesis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7jvs, PDBe:7jvs, PDBj:7jvs
PDBsum7jvs
PubMed
UniProtQ2FXS9|PRP_STAA8 Ribosomal processing cysteine protease Prp (Gene Name=prp)

[Back to BioLiP]