Structure of PDB 7jm4 Chain B Binding Site BS01

Receptor Information
>7jm4 Chain B (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFK
AWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPY
KVYRIVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7jm4 Structural determinants of the IRF4/DNA homodimeric complex.
Resolution2.95 Å
Binding residue
(original residue number in PDB)
W54 H56 A57 P91 K94 R98
Binding residue
(residue number reindexed from 1)
W32 H34 A35 P69 K72 R76
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:7jm4, PDBe:7jm4, PDBj:7jm4
PDBsum7jm4
PubMed33533913
UniProtQ15306|IRF4_HUMAN Interferon regulatory factor 4 (Gene Name=IRF4)

[Back to BioLiP]