Structure of PDB 7fhj Chain B Binding Site BS01

Receptor Information
>7fhj Chain B (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRIATPEEVRLPLQHGWRREVRIKKGSHRWQGETWYYGPCGKRMKQFPEV
IKYLSRNVVHSVRREHFSFSPRMPVGDFFEERDTPEGLQWVQLSAEEIPS
RIQAITG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7fhj Structural basis of the TAM domain of BAZ2A in binding to DNA or RNA independent of methylation status.
Resolution2.28 Å
Binding residue
(original residue number in PDB)
K585 Q589
Binding residue
(residue number reindexed from 1)
K42 Q46
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:7fhj, PDBe:7fhj, PDBj:7fhj
PDBsum7fhj
PubMed34715126
UniProtQ9UIF9|BAZ2A_HUMAN Bromodomain adjacent to zinc finger domain protein 2A (Gene Name=BAZ2A)

[Back to BioLiP]