Structure of PDB 7f60 Chain B Binding Site BS01

Receptor Information
>7f60 Chain B (length=330) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPK
AQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPV
KTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIY
PMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTG
FALGSIEGRVAIHYINPPNPAKDNFTFKCHRSSAPQDIYAVNGIAFHPVH
GTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASS
YDWSKGHEFYNPQKKNYIFLRNAAEELKPR
Ligand information
>7f60 Chain F (length=7) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EQPMEID
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f60 Structural basis for Sarbecovirus ORF6 mediated blockage of nucleocytoplasmic transport
Resolution2.85 Å
Binding residue
(original residue number in PDB)		R239 T256 F257 K258 W300 R305 T306 K307
Binding residue
(residue number reindexed from 1)		R209 T226 F227 K228 W265 R270 T271 K272
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008017 microtubule binding
GO:0043130 ubiquitin binding
Biological Process
GO:0000972 transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery
GO:0006405 RNA export from nucleus
GO:0006406 mRNA export from nucleus
GO:0006913 nucleocytoplasmic transport
GO:0051301 cell division
GO:0060236 regulation of mitotic spindle organization
GO:0071407 cellular response to organic cyclic compound
Cellular Component
GO:0000922 spindle pole
GO:0001650 fibrillar center
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005643 nuclear pore
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0097431 mitotic spindle pole

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7f60, PDBe:7f60, PDBj:7f60
PDBsum7f60
PubMed
UniProtP78406|RAE1L_HUMAN mRNA export factor RAE1 (Gene Name=RAE1)

[Back to BioLiP]