Structure of PDB 7f5m Chain B Binding Site BS01

Receptor Information
>7f5m Chain B (length=122) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SIEVTFRVKTQQVRRWQMELLMLDATGKEVEPTILSKCIYHLHSSFKQPK
RRLNSLPFFIKETGWGEFNLKIECFFIGNAGKFSIEHDLTFEDDAYAVDY
TVDVPHEFSHLNSELSKYFDLP
Ligand information
>7f5m Chain C (length=20) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KQLASKAARGSAPSTGGVKY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f5m Global profiling of regulatory elements in the histone benzoylation pathway.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R10 G44 K45 E46 D110 Y113 A114 D116
Binding residue
(residue number reindexed from 1)		R7 G27 K28 E29 D93 Y96 A97 D99
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:7f5m, PDBe:7f5m, PDBj:7f5m
PDBsum7f5m
PubMed35296687
UniProtQ99314|SAS5_YEAST Something about silencing protein 5 (Gene Name=SAS5)

[Back to BioLiP]