Structure of PDB 7f4m Chain B Binding Site BS01

Receptor Information
>7f4m Chain B (length=130) Species: 312017 (Tetrahymena thermophila SB210) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLDFTQYAKNMRKDLSNQDICLEDGALNHSYFLTKKGQYWTPLNQKALQR
GIELFGVGNWKEINYDEFSGKANIVELELRTCMILGINDITEYYGKKISE
EEQEEIKKSNIAKGKKENKLKDNIYQKLQQ
Ligand information
>7f4m Chain F (length=25) Species: 312017 (Tetrahymena thermophila SB210) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KFTNLEILTHLYNLKAEIVRRLAEQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f4m Structural basis for MTA1c-mediated DNA N6-adenine methylation
Resolution3.58 Å
Binding residue
(original residue number in PDB)		K45 Q48 N83 V85 E86
Binding residue
(residue number reindexed from 1)		K35 Q38 N73 V75 E76
Enzymatic activity
Enzyme Commision number ?
External links