Structure of PDB 7eyc Chain B Binding Site BS01

Receptor Information
>7eyc Chain B (length=217) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DVVMTQTPLSLPVTLGQPASISCKSSQSLLDSDGKTYLNWFQQRPGQSPK
RLISLVSKLDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCWQGSHFP
YTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK
VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE
VTHQGLSSPVTKSFNRG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7eyc Monoclonal antibody Y01 prevents tauopathy progression induced by lysine 280-acetylated tau in cell and mouse models.
Resolution2.49 Å
Binding residue
(original residue number in PDB)		D27D Y32 N34 R46 L50 W89 G91 F94 Y96
Binding residue
(residue number reindexed from 1)		D31 Y37 N39 R51 L55 W94 G96 F99 Y101
External links