Structure of PDB 7ef2 Chain B Binding Site BS01

Receptor Information

>7ef2 Chain B (length=142) Species: 4577 (Zea mays) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SVSVEFEAKSARDGAWYDVAAFLSHRLFESGDPEVRVRFSGFGAEEDEWI
NVRKCVRQRSLPCEATECVAVLPGDLILCFQEGKDQALYYDAHVLDAQRR
RHDVGGCRCRFLVRYDHDSSEEIVPLRKVCRRPETDYRLQIL

Ligand information

>7ef2 Chain Q (length=7) Species: 4577 (Zea mays) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

TKQTARK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7ef2 Recognition of H3K9me1 by maize RNA-directed DNA methylation factor SHH2.
Resolution	2.0 Å
Binding residue (original residue number in PDB)	Y147 D148 P192 F210 D215 Q216 A217 Y219
Binding residue (residue number reindexed from 1)	Y17 D18 P62 F80 D85 Q86 A87 Y89

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003682	chromatin binding

View graph for
Molecular Function

External links

PDB	RCSB:7ef2, PDBe:7ef2, PDBj:7ef2
PDBsum	7ef2
PubMed	33913587
UniProt	B7ZYP9

[Back to BioLiP]