Structure of PDB 7e87 Chain B Binding Site BS01

Receptor Information

>7e87 Chain B (length=388) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DALIVLNVSGTRFQTWQDTLERYPDTLLGSSERDFFYHPETQQYFFDRDP
DIFRHILNFYRTGKLHYPRHECISAYDEELAFFGLIPEIIGDCCYEEYKD
RRRENAERLQDDADTDTAGESARQRVWRAFENPHTSTMALVFYYVTGFFI
AVSVIANVVETVPCGSSPGHIKELRYAVAFFCLDTACVMIFTVEYLLRLA
AAPSRYRFVRSVMSIIDVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFR
IFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGS
SASKFTSIPAAFWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIA
LPVPVIVSNFSRIYHQNQRADKRRAQKKARLARIRAAK

Ligand information

>7e87 Chain J (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

WKGIAIALLVILVICSLIVTSVILLTPA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7e87 Structural basis of gating modulation of Kv4 channel complexes.
Resolution	3.4 Å
Binding residue (original residue number in PDB)	Y189 V190 F193 F194
Binding residue (residue number reindexed from 1)	Y144 V145 F148 F149

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005216	monoatomic ion channel activity
GO:0005249	voltage-gated potassium channel activity

	Biological Process
GO:0006811	monoatomic ion transport
GO:0006813	potassium ion transport
GO:0051260	protein homooligomerization
GO:0055085	transmembrane transport

	Cellular Component
GO:0008076	voltage-gated potassium channel complex
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7e87, PDBe:7e87, PDBj:7e87
PDBsum	7e87
PubMed	34552243
UniProt	Q9NZV8\|KCND2_HUMAN A-type voltage-gated potassium channel KCND2 (Gene Name=KCND2)

[Back to BioLiP]