Structure of PDB 7e1t Chain B Binding Site BS01

Receptor Information
>7e1t Chain B (length=174) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHF
VTMQIWDTAGLERFRSLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEF
IYYADVKEPESFPFVILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSA
KDATNVAAAFEEAVRRVLATEDRS
Ligand information
>7e1t Chain D (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MDDLAQTKAIKDQLQKYIRELEQAN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7e1t Nde1 is a Rab9 effector for loading late endosomes to cytoplasmic dynein motor complex.
Resolution2.45 Å
Binding residue
(original residue number in PDB)		F37 H38 I40 E43 R68
Binding residue
(residue number reindexed from 1)		F32 H33 I35 E38 R63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0019003 GDP binding
Biological Process
GO:0015031 protein transport
GO:0032482 Rab protein signal transduction
GO:0032880 regulation of protein localization
GO:0042147 retrograde transport, endosome to Golgi
GO:0045921 positive regulation of exocytosis
GO:0052403 negative regulation by host of symbiont catalytic activity
Cellular Component
GO:0000139 Golgi membrane
GO:0005764 lysosome
GO:0005768 endosome
GO:0005770 late endosome
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0030133 transport vesicle
GO:0030670 phagocytic vesicle membrane
GO:0032588 trans-Golgi network membrane
GO:0042470 melanosome
GO:0045335 phagocytic vesicle
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7e1t, PDBe:7e1t, PDBj:7e1t
PDBsum7e1t
PubMed34793709
UniProtP51151|RAB9A_HUMAN Ras-related protein Rab-9A (Gene Name=RAB9A)

[Back to BioLiP]