Structure of PDB 7dwh Chain B Binding Site BS01

Receptor Information
>7dwh Chain B (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFV
IFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSD
Ligand information
>7dwh Chain Y (length=45) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggaccuacuacgagcgccauugcacuccggcgccacggggggucc
<<<<<<.<<.<<.<<<<<..........>>>>>..>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dwh The identification and characterization of a selected SAM-dependent methyltransferase ribozyme that is present in natural sequences
Resolution3.1 Å
Binding residue
(original residue number in PDB)		Y13 N16 E19 K22 S48 L49 K50 M51 R52 Q54 F56 K80 R83 Q85 Y86 A87 K88 T89 S91 D92
Binding residue
(residue number reindexed from 1)		Y6 N9 E12 K15 S41 L42 K43 M44 R45 Q47 F49 K73 R76 Q78 Y79 A80 K81 T82 S84 D85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:7dwh, PDBe:7dwh, PDBj:7dwh
PDBsum7dwh
PubMed
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]