Structure of PDB 7dsb Chain B Binding Site BS01

Receptor Information
>7dsb Chain B (length=243) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIAR
DKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEAN
NAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSI
HVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDE
TVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dsb Structural Insights into the Regulation of Actin Capping Protein by Twinfilin C-terminal Tail.
Resolution2.44 Å
Binding residue
(original residue number in PDB)		E37 L40 S41 D63 Y64 R66 D67 G68 D69 D85 W122 A129 V153 E155 K168 T170 Q196 E198
Binding residue
(residue number reindexed from 1)		E36 L39 S40 D62 Y63 R65 D66 G67 D68 D84 W121 A128 V152 E154 K167 T169 Q195 E197
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0030036 actin cytoskeleton organization
GO:0051016 barbed-end actin filament capping
Cellular Component
GO:0005737 cytoplasm
GO:0008290 F-actin capping protein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7dsb, PDBe:7dsb, PDBj:7dsb
PDBsum7dsb
PubMed33639213
UniProtP14315|CAPZB_CHICK F-actin-capping protein subunit beta isoforms 1 and 2 (Gene Name=CAPZB)

[Back to BioLiP]