Structure of PDB 7ds3 Chain B Binding Site BS01

Receptor Information
>7ds3 Chain B (length=234) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARD
KVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANN
AFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGIKGCWDSIHVVE
VQETAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHI
ANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ds3 Structural Insights into the Regulation of Actin Capping Protein by Twinfilin C-terminal Tail.
Resolution2.09 Å
Binding residue
(original residue number in PDB)		E37 L40 S41 K48 D63 Y64 R66 D67 G68 D69 W122 A129 V153 E155 K168 T170 Q196
Binding residue
(residue number reindexed from 1)		E35 L38 S39 K46 D61 Y62 R64 D65 G66 D67 W120 A127 V148 E150 K158 T160 Q186
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0030036 actin cytoskeleton organization
GO:0051016 barbed-end actin filament capping
Cellular Component
GO:0005737 cytoplasm
GO:0008290 F-actin capping protein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ds3, PDBe:7ds3, PDBj:7ds3
PDBsum7ds3
PubMed33639213
UniProtP14315|CAPZB_CHICK F-actin-capping protein subunit beta isoforms 1 and 2 (Gene Name=CAPZB)

[Back to BioLiP]