Structure of PDB 7dro Chain B Binding Site BS01

Receptor Information

>7dro Chain B (length=300) Species: 391625 (Plesiocystis pacifica SIR-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NLDTSIVVVGSPDDLHVQSVTEGLRARGHEPYVFDTQRFPEEMTVSLGEQ
GASIFVDGQQIARPAAVYLRSLYADKAMQDNWRRTLLAFRERSTLMSAVL
LRWEEAGTAVYNSPRASANITKPFQLALLRDAGLPVPRSLWTNDPEAVRR
FHAEVGDCIYKPVAGGARTRKLEAKDLEADRIERLSAAPVCFQELLTGDD
VRVYVIDDQVICALRIVTDEIDFRQAEERIEAIEISDEVKDQCVRAAKLV
GLRYTGMDIKADGNYRVLELNASAMFRGFEGRANVDICGPLCDALIAQTK

Ligand information

>7dro Chain H (length=5) Species: 391625 (Plesiocystis pacifica SIR-1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

FIEDL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7dro Molecular mechanism underlying substrate recognition of the peptide macrocyclase PsnB.
Resolution	3.25 Å
Binding residue (original residue number in PDB)	Y171 P173 A178 R192
Binding residue (residue number reindexed from 1)	Y160 P162 A167 R181

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005524	ATP binding
GO:0016879	ligase activity, forming carbon-nitrogen bonds
GO:0046872	metal ion binding

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:7dro, PDBe:7dro, PDBj:7dro
PDBsum	7dro
PubMed	34475564
UniProt	A6G4D7

[Back to BioLiP]