Structure of PDB 7dne Chain B Binding Site BS01

Receptor Information
>7dne Chain B (length=154) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLGKKLLEAARAGQDDEVRILLANGADVNTADETGFTPLHLAAWEGHLGI
VEVLLKNGADVNANDERGHTPLHLAAYTGHLEIVEVLLKNGAGVNATDVI
GTAPLHLAAMWGHLEIVEVLLKNGADVNIQDKFGKTAFDISIDNGNEDLA
EILQ
Ligand information
>7dne Chain D (length=16) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KRIHIGPGRAFYTTPP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dne Distinct conformations of the HIV-1 V3 loop crown are targetable for broad neutralization.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R23 F48 L53 W56 R79 H81 Y89 D110 I112 T114 M122 D143 F145
Binding residue
(residue number reindexed from 1)		R11 F36 L41 W44 R67 H69 Y77 D98 I100 T102 M110 D131 F133
External links