Structure of PDB 7dlz Chain B Binding Site BS01

Receptor Information
>7dlz Chain B (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFV
IFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDII
Ligand information
>7dlz Chain Y (length=45) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggaccuacuacgagcgccauugcacuccggcgccacggggggucc
<<<<<<.<<.<<.<<<<<..........>>>>>..>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dlz The identification and characterization of a selected SAM-dependent methyltransferase ribozyme that is present in natural sequences
Resolution3.002 Å
Binding residue
(original residue number in PDB)		Y13 N15 N16 K22 S48 L49 K50 R52 G53 F56 Y86 A87 K88 T89 D90 S91 D92
Binding residue
(residue number reindexed from 1)		Y6 N8 N9 K15 S41 L42 K43 R45 G46 F49 Y79 A80 K81 T82 D83 S84 D85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:7dlz, PDBe:7dlz, PDBj:7dlz
PDBsum7dlz
PubMed
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]