Structure of PDB 7dcj Chain B Binding Site BS01

Receptor Information
>7dcj Chain B (length=110) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GHHHHHHVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVL
PKYFKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPDTEFQHPCFLRGQEQ
LLENIKRKVT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dcj Structures of heat shock factor trimers bound to DNA.
Resolution2.004 Å
Binding residue
(original residue number in PDB)		G8 H9 H14 F18 K62 H63 N65 S68 R71 Q72 Y76 R117
Binding residue
(residue number reindexed from 1)		G1 H2 H7 F11 K55 H56 N58 S61 R64 Q65 Y69 R107
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7dcj, PDBe:7dcj, PDBj:7dcj
PDBsum7dcj
PubMed34458700
UniProtQ00613|HSF1_HUMAN Heat shock factor protein 1 (Gene Name=HSF1)

[Back to BioLiP]