Structure of PDB 7d3d Chain B Binding Site BS01

Receptor Information
>7d3d Chain B (length=138) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDE
ESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQG
KDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7d3d A peptide binder of E3 ligase adaptor SPOP disrupts oncogenic SPOP-protein interactions in kidney cancer cells.
Resolution1.45 Å
Binding residue
(original residue number in PDB)		Y87 T114 A116 M117 E118 S119 Q120 Y123 K129 D130 W131 G132 F133 K134
Binding residue
(residue number reindexed from 1)		Y59 T86 A88 M89 E90 S91 Q92 Y95 K101 D102 W103 G104 F105 K106
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7d3d, PDBe:7d3d, PDBj:7d3d
PDBsum7d3d
PubMed
UniProtO43791|SPOP_HUMAN Speckle-type POZ protein (Gene Name=SPOP)

[Back to BioLiP]