Structure of PDB 7csw Chain B Binding Site BS01

Receptor Information

>7csw Chain B (length=92) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PIHPGEILRDEFLMEFDISPAALARALKVSAPTVNDIVREQRGISADMAI
RLGRYFDTSAQFWMNLQSEYSLATAYAANGKQIEHEIEPLLA

Ligand information

>7csw Chain C (length=7) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

attgcga

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7csw Pseudomonas aeruginosa antitoxin HigA functions as a diverse regulatory factor by recognizing specific pseudopalindromic DNA motifs.
Resolution	1.97 Å
Binding residue (original residue number in PDB)	S37 T40 R49 G50 S52
Binding residue (residue number reindexed from 1)	S30 T33 R42 G43 S45

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

View graph for
Molecular Function

External links

PDB	RCSB:7csw, PDBe:7csw, PDBj:7csw
PDBsum	7csw
PubMed	33346387
UniProt	Q9HVC1

[Back to BioLiP]