Structure of PDB 7cq4 Chain B Binding Site BS01

Receptor Information
>7cq4 Chain B (length=115) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CEIMMSQSMKELRQSLKTVGLKPMRTKVEIIQSLQTASQILSTANNFSKI
EIFDHLTELIEAFPDFLERIYTFEPIPLNELIEKLFSAEPFVSQIDEMTI
REWADVQGICLRNDK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cq4 Structure specific DNA recognition by the SLX1-SLX4 endonuclease complex.
Resolution3.294 Å
Binding residue
(original residue number in PDB)		R634 P644
Binding residue
(residue number reindexed from 1)		R13 P23
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006260 DNA replication
GO:0006281 DNA repair
Cellular Component
GO:0005634 nucleus
GO:0033557 Slx1-Slx4 complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7cq4, PDBe:7cq4, PDBj:7cq4
PDBsum7cq4
PubMed34181713
UniProtQ12098|SLX4_YEAST Structure-specific endonuclease subunit SLX4 (Gene Name=SLX4)

[Back to BioLiP]