Structure of PDB 7cfd Chain B Binding Site BS01

Receptor Information

>7cfd Chain B (length=178) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IGSIVGILITFINGPTEVYGQFLDGSPPLVWDKKDVPENKRTFKSKPRLL
DIVLALYSDGCFYRAQIIDEFPSEYMIFYVDYGNTEFVPLSCLAPCENVD
SFKPHRVFSFHIEGIVRSKNLTHQKTIECIEYLKSKLLNTEMNVHLVQRL
PDGFLIRFLDDWKYIPEQLLQRNYAQVS

Ligand information

>7cfd Chain I (length=4) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RGRG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7cfd Binding of guide piRNA triggers methylation of the unstructured N-terminal region of Aub leading to assembly of the piRNA amplification complex.
Resolution	2.704 Å
Binding residue (original residue number in PDB)	P595 Y624 Y630 Y646 Y649 N651 N706
Binding residue (residue number reindexed from 1)	P28 Y57 Y63 Y79 Y82 N84 N139

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:7cfd, PDBe:7cfd, PDBj:7cfd
PDBsum	7cfd
PubMed	34210982
UniProt	A1ZAC4

[Back to BioLiP]