Structure of PDB 7cc9 Chain B Binding Site BS01

Receptor Information
>7cc9 Chain B (length=162) Species: 38300 (Streptomyces pristinaespiralis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TDTDRSEDFLRRVRGLKAARTANGPRLYQPITLLWAVGRARRGEARTLAW
ADTDEAIGALLKRHGARGERPRPDYPVLALHRAGLWTLEGHVGEVPTAHG
DSALRNWFAEQRPVGGLAEPFHDLLHRSGHSRVSVIEALLTTYFAGLDPV
PLLEDTGLYDEG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cc9 DNA backbone interactions impact the sequence specificity of DNA sulfur-binding domains: revelations from structural analyses.
Resolution2.063 Å
Binding residue
(original residue number in PDB)		K20 A21 A22 R29 Y31 Q32 R73 Y78 P79 R85 A101 H102 G103 D104
Binding residue
(residue number reindexed from 1)		K17 A18 A19 R26 Y28 Q29 R70 Y75 P76 R82 A98 H99 G100 D101
Enzymatic activity
Enzyme Commision number ?
External links