Structure of PDB 7c8e Chain B Binding Site BS01

Receptor Information
>7c8e Chain B (length=230) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNV
IGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILD
VLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAY
KAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDA
IAELDTLSEESYKDSTLIMQLLRDNLTLWT
Ligand information
>7c8e Chain D (length=7) Species: 227882 (Streptomyces avermitilis MA-4680 = NBRC 14893) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GRRRNSN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7c8e Target identification for small-molecule discovery in the FOXO3a tumor-suppressor pathway using a biodiverse peptide library.
Resolution3.16 Å
Binding residue
(original residue number in PDB)		R57 R61 K123 R130 Y131 N176 E183 I220 L223 D226 N227
Binding residue
(residue number reindexed from 1)		R55 R59 K121 R128 Y129 N174 E181 I218 L221 D224 N225
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005246 calcium channel regulator activity
GO:0005515 protein binding
GO:0015459 potassium channel regulator activity
GO:0019855 calcium channel inhibitor activity
GO:0019899 enzyme binding
GO:0019903 protein phosphatase binding
GO:0019904 protein domain specific binding
GO:0023026 MHC class II protein complex binding
GO:0031625 ubiquitin protein ligase binding
GO:0035591 signaling adaptor activity
GO:0042802 identical protein binding
GO:0042826 histone deacetylase binding
GO:0044325 transmembrane transporter binding
GO:0045296 cadherin binding
GO:0046982 protein heterodimerization activity
GO:0050815 phosphoserine residue binding
GO:0051219 phosphoprotein binding
GO:0097110 scaffold protein binding
GO:0140311 protein sequestering activity
Biological Process
GO:0000165 MAPK cascade
GO:0001764 neuron migration
GO:0002753 cytoplasmic pattern recognition receptor signaling pathway
GO:0003064 regulation of heart rate by hormone
GO:0006605 protein targeting
GO:0007165 signal transduction
GO:0007346 regulation of mitotic cell cycle
GO:0008104 protein localization
GO:0021762 substantia nigra development
GO:0021766 hippocampus development
GO:0021987 cerebral cortex development
GO:0034122 negative regulation of toll-like receptor signaling pathway
GO:0034504 protein localization to nucleus
GO:0034605 cellular response to heat
GO:0035332 positive regulation of hippo signaling
GO:0035556 intracellular signal transduction
GO:0046827 positive regulation of protein export from nucleus
GO:0051220 cytoplasmic sequestering of protein
GO:0051480 regulation of cytosolic calcium ion concentration
GO:0060306 regulation of membrane repolarization
GO:0070972 protein localization to endoplasmic reticulum
GO:0086013 membrane repolarization during cardiac muscle cell action potential
GO:0086091 regulation of heart rate by cardiac conduction
GO:1901016 regulation of potassium ion transmembrane transporter activity
GO:1905913 negative regulation of calcium ion export across plasma membrane
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005925 focal adhesion
GO:0016020 membrane
GO:0031966 mitochondrial membrane
GO:0042470 melanosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7c8e, PDBe:7c8e, PDBj:7c8e
PDBsum7c8e
PubMed34111400
UniProtP62258|1433E_HUMAN 14-3-3 protein epsilon (Gene Name=YWHAE)

[Back to BioLiP]