Structure of PDB 7b1j Chain B Binding Site BS01

Receptor Information
>7b1j Chain B (length=122) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTE
NQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRR
QDSIPAFLSSLTLELFSRQTVA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7b1j Molecular mechanism of Mad1 kinetochore targeting by phosphorylated Bub1.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		Q623 I626 R630
Binding residue
(residue number reindexed from 1)		Q27 I30 R34
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007094 mitotic spindle assembly checkpoint signaling

View graph for
Biological Process
External links
PDB RCSB:7b1j, PDBe:7b1j, PDBj:7b1j
PDBsum7b1j
PubMed34013668
UniProtQ9Y6D9|MD1L1_HUMAN Mitotic spindle assembly checkpoint protein MAD1 (Gene Name=MAD1L1)

[Back to BioLiP]