Structure of PDB 7azx Chain B Binding Site BS01

Receptor Information
>7azx Chain B (length=113) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMASMDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACS
EYFKMLFVDQKVHLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATF
LQMQDIITACHAL
Ligand information
>7azx Chain C (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HAVLVLQPAVEAFFLVHATER
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7azx Identification of an atypical interaction site in the BTB domain of the MYC-interacting zinc-finger protein 1.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		D25 T27 F28 V29 F53 V60 H61 L62
Binding residue
(residue number reindexed from 1)		D29 T31 F32 V33 F57 V62 H63 L64
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7azx, PDBe:7azx, PDBj:7azx
PDBsum7azx
PubMed34186024
UniProtQ13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 (Gene Name=ZBTB17)

[Back to BioLiP]