Structure of PDB 7az8 Chain B Binding Site BS01

Receptor Information
>7az8 Chain B (length=365) Species: 1444266 (Escherichia coli 2-427-07_S4_C3) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMKFTVEREHLLKPLQQVSGPLTLPILGNLLLQVADGTLSLTGTDLEM
EMVARVALVQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVRS
GRSRFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDV
RYYLNGMLFETEGEELRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVI
ELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKN
PDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITANNPEQEE
AEEILDVTYSGAEMEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIED
AASQSAAYVVMPMRL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7az8 Iterative Structure-Based Optimization of Short Peptides Targeting the Bacterial Sliding Clamp.
Resolution1.61 Å
Binding residue
(original residue number in PDB)		G174 H175 R176 P242 V344 M362 P363 M364 R365
Binding residue
(residue number reindexed from 1)		G173 H174 R175 P241 V343 M361 P362 M363 R364
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003887 DNA-directed DNA polymerase activity
GO:0005515 protein binding
GO:0008408 3'-5' exonuclease activity
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0006260 DNA replication
GO:0006261 DNA-templated DNA replication
GO:0006271 DNA strand elongation involved in DNA replication
GO:0006974 DNA damage response
GO:0030174 regulation of DNA-templated DNA replication initiation
GO:0032297 negative regulation of DNA-templated DNA replication initiation
GO:0042276 error-prone translesion synthesis
GO:0044787 bacterial-type DNA replication
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0009360 DNA polymerase III complex
GO:0030894 replisome
GO:1990078 replication inhibiting complex
GO:1990085 Hda-beta clamp complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7az8, PDBe:7az8, PDBj:7az8
PDBsum7az8
PubMed34806883
UniProtP0A988|DPO3B_ECOLI Beta sliding clamp (Gene Name=dnaN)

[Back to BioLiP]