Structure of PDB 7apo Chain B Binding Site BS01

Receptor Information
>7apo Chain B (length=233) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSEL
STKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQ
DTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSA
ICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRRPHMFPKMLMKITD
LRSISAKGAERVITLKMEIPGSMPPLIQEMLEN
Ligand information
>7apo Chain D (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HKILHRLLQDSSSPVDLAKLTAEATG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7apo Structural Insights into the Interaction of the Intrinsically Disordered Co-activator TIF2 with Retinoic Acid Receptor Heterodimer (RXR/RAR).
Resolution2.4 Å
Binding residue
(original residue number in PDB)		T233 I237 I258 P408 L409 M413
Binding residue
(residue number reindexed from 1)		T52 I56 I77 P225 L226 M230
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0048384 retinoic acid receptor signaling pathway
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7apo, PDBe:7apo, PDBj:7apo
PDBsum7apo
PubMed33647291
UniProtP10276|RARA_HUMAN Retinoic acid receptor alpha (Gene Name=RARA)

[Back to BioLiP]