Structure of PDB 7amt Chain B Binding Site BS01

Receptor Information
>7amt Chain B (length=183) Species: 663 (Vibrio alginolyticus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSPIKRKQQLMEIALEVFARRGIGRGGHADIAEIAQVSVATVFNYFPTRE
DLVDEVLNHVVRQFSNFLSDNIDLDLHARENIANITNAMIELVSQDCHWL
KVWFEWSASTRDEVWPLFVSTNRTNQLLVQNMFIKAIERGEVCHDSEHLA
NLFHGICYSLFVQANRAAELKHLVNSYLDMLCI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7amt Binding site profiles and N-terminal minor groove interactions of the master quorum-sensing regulator LuxR enable flexible control of gene activation and repression.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		L12 P14 R17 R36 S49 A51 T52 N55 Y56
Binding residue
(residue number reindexed from 1)		L1 P3 R6 R25 S38 A40 T41 N44 Y45
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7amt, PDBe:7amt, PDBj:7amt
PDBsum7amt
PubMed33693882
UniProtB4X9Q4

[Back to BioLiP]