Structure of PDB 7ad3 Chain B Binding Site BS01

Receptor Information
>7ad3 Chain B (length=298) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNLFYDPTYNPGQSTINYTSIYGNGSTITFDELQGLVNSTVTQAIMFGVR
CGAAALTLIVMWMTSRSRKTPIFIINQVSLFLIILHSALYFKYLLSNYSS
VTYALTGFPQFISRGDVHVYGATNIIQVLLVASIETSLVFQIKVIFTGDN
FKRIGLMLTSISFTLGIATVTMYFVSAVKGMIVTYNDVSATQDKYFNAST
ILLASSINFMSFVLVVKLILAIRSRRFLGLKQFDSFHILLIMSCQSLLVP
SIIFILAYSLKPNQGTDVLTTVATLLAVLSLPLSSMWATAANNASKTN
Ligand information
>7ad3 Chain K (length=13) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WHWLQLKPGQPMY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ad3 Structure of the class D GPCR Ste2 dimer coupled to two G proteins.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		Y98 Y101 Y106 Y128 T131 N132 Q135 S184 A185 S197 T199 F204 N205 A265 Y266 L268 D275 V276 T278 T279
Binding residue
(residue number reindexed from 1)		Y90 Y93 Y98 Y120 T123 N124 Q127 S176 A177 S189 T191 F196 N197 A257 Y258 L260 D267 V268 T270 T271
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004932 mating-type factor pheromone receptor activity
GO:0004934 mating-type alpha-factor pheromone receptor activity
GO:0005515 protein binding
Biological Process
GO:0000750 pheromone-dependent signal transduction involved in conjugation with cellular fusion
GO:0000755 cytogamy
GO:0007186 G protein-coupled receptor signaling pathway
GO:0019236 response to pheromone
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0038038 G protein-coupled receptor homodimeric complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ad3, PDBe:7ad3, PDBj:7ad3
PDBsum7ad3
PubMed33268889
UniProtD6VTK4|STE2_YEAST Pheromone alpha factor receptor (Gene Name=STE2)

[Back to BioLiP]