Structure of PDB 7ac4 Chain B Binding Site BS01

Receptor Information

>7ac4 Chain B (length=30) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Ligand information

>7ac4 Chain A (length=21) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GIVEQCCTSICSLYQLENYCN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7ac4 Versatile microporous polymer-based supports for serial macromolecular crystallography.
Resolution	1.46 Å
Binding residue (original residue number in PDB)	V2 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 P28
Binding residue (residue number reindexed from 1)	V2 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 P28

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005179	hormone activity

	Cellular Component
GO:0005576	extracellular region

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:7ac4, PDBe:7ac4, PDBj:7ac4
PDBsum	7ac4
PubMed	34473086
UniProt	P01315\|INS_PIG Insulin (Gene Name=INS)

[Back to BioLiP]