Structure of PDB 7a79 Chain B Binding Site BS01

Receptor Information

>7a79 Chain B (length=217) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SMDMPVERILEAELAVEPKTNDPVTNICHAADKQLFTLVEWAKRIPHFSD
LTLEDQVILLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAG
VGSIFDRVLTELVSKMKDMQMDKSELGCLRAIVLFNPDAKGLSNPSEVET
LREKVYATLEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKL
IGDTPIDTFLMEMLETP

Ligand information

>7a79 Chain D (length=13) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KHKILHRLLQDSS

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7a79 Comprehensive Set of Tertiary Complex Structures and Palmitic Acid Binding Provide Molecular Insights into Ligand Design for RXR Isoforms.
Resolution	2.05 Å
Binding residue (original residue number in PDB)	V281 K285 L295 V299 R303 T450 F451 E454
Binding residue (residue number reindexed from 1)	V39 K43 L53 V57 R61 T208 F209 E212

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003707	nuclear steroid receptor activity
GO:0008270	zinc ion binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7a79, PDBe:7a79, PDBj:7a79
PDBsum	7a79
PubMed	33187070
UniProt	P48443\|RXRG_HUMAN Retinoic acid receptor RXR-gamma (Gene Name=RXRG)

[Back to BioLiP]