Structure of PDB 7a4y Chain B Binding Site BS01

Receptor Information
>7a4y Chain B (length=115) Species: 9844 (Lama glama) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLQESGGGLVQPGGSLRLSCAASQFTFSSDWMYWVRQAPGKGLEWVSSIS
PGGAATAYAASVKGRFTISRDNAKNTLYLQMNSLKSEDTAVYYCSKTRAG
TGRGQGTQVTVSSGR
Ligand information
>7a4y Chain D (length=29) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KNSELKEEIQQLEEENQQLEEKISELKYG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7a4y A nanobody toolbox targeting dimeric coiled-coil modules for functionalization of designed protein origami structures.
Resolution2.157 Å
Binding residue
(original residue number in PDB)		W47 S50 A59 Y60 A61 A62 K65 R100
Binding residue
(residue number reindexed from 1)		W45 S48 A57 Y58 A59 A60 K63 R98
External links