Structure of PDB 7a00 Chain B Binding Site BS01

Receptor Information
>7a00 Chain B (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSDYIIKEKTVLLQKKDSEGFGFVLRGAKAQFTPTPAFPALQYLESV
DEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVM
VTRHPDM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7a00 Query-guided protein-protein interaction inhibitor discovery.
Resolution1.78 Å
Binding residue
(original residue number in PDB)
G673 F674 G675 F676 V677 L678 R679 G680 Y701 E703 D706 H735 V739 I742
Binding residue
(residue number reindexed from 1)
G23 F24 G25 F26 V27 L28 R29 G30 Y46 E48 D51 H80 V84 I87
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7a00, PDBe:7a00, PDBj:7a00
PDBsum7a00
PubMed34163731
UniProtQ9Y566|SHAN1_HUMAN SH3 and multiple ankyrin repeat domains protein 1 (Gene Name=SHANK1)

[Back to BioLiP]