Structure of PDB 6zuf Chain B Binding Site BS01

Receptor Information
>6zuf Chain B (length=154) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAES
EEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCT
YRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFH
INWE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zuf Optimal anchoring of a foldamer inhibitor of ASF1 histone chaperone through backbone plasticity.
Resolution1.798 Å
Binding residue
(original residue number in PDB)		E49 E51 D54 A87 D88 V94 R108 G110 Y112 R145
Binding residue
(residue number reindexed from 1)		E49 E51 D54 A87 D88 V94 R108 G110 Y112 R145
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zuf, PDBe:6zuf, PDBj:6zuf
PDBsum6zuf
PubMed33741589
UniProtQ9Y294|ASF1A_HUMAN Histone chaperone ASF1A (Gene Name=ASF1A)

[Back to BioLiP]