Structure of PDB 6zot Chain B Binding Site BS01

Receptor Information
>6zot Chain B (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HPVLEKLKAINNYNPKDFDWNLKNGRVFIIKSYSEDDIHRSIKYSIWCST
EHGNKRLDAAYRSLNGKGPLYLLFSVNGSGHFCGVAEMKSVVDYNAYAGV
WSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLE
KAKQVLKIIATFKHTTSIFDDFAHYEKRQE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zot Structural and Dynamic Insights into Redundant Function of YTHDF Proteins.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		K422 S423 Y424 D428 W438 C439 N468 G469 W492 W497 T530 N531 S532 R533 D534
Binding residue
(residue number reindexed from 1)		K31 S32 Y33 D37 W47 C48 N77 G78 W101 W106 T139 N140 S141 R142 D143
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6zot, PDBe:6zot, PDBj:6zot
PDBsum6zot
PubMed33073985
UniProtQ7Z739|YTHD3_HUMAN YTH domain-containing family protein 3 (Gene Name=YTHDF3)

[Back to BioLiP]