Structure of PDB 6zmn Chain B Binding Site BS01

Receptor Information
>6zmn Chain B (length=119) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPAVKRLLGWKQGDEEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVN
TKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEF
AFNMKKDEVCVNPYHYQRV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zmn Unveiling the dimer/monomer propensities of Smad MH1-DNA complexes.
Resolution2.333 Å
Binding residue
(original residue number in PDB)		S67 L68 Q73 S75 H76 K78
Binding residue
(residue number reindexed from 1)		S59 L60 Q65 S67 H68 K70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005667 transcription regulator complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zmn, PDBe:6zmn, PDBj:6zmn
PDBsum6zmn
PubMed33510867
UniProtP84022|SMAD3_HUMAN Mothers against decapentaplegic homolog 3 (Gene Name=SMAD3)

[Back to BioLiP]