Structure of PDB 6zlc Chain B Binding Site BS01

Receptor Information
>6zlc Chain B (length=72) Species: 437402 (Influenza A virus (A/turkey/Italy/977/1999(H7N1))) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDSNTITSFQVDCYLWHIRKLLSMRDMCDAPFDDRLRRDQKALKGRGSTL
GLDLRVATMEGKKIVEDILKSE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zlc Structure and Sequence Determinants Governing the Interactions of RNAs with Influenza A Virus Non-Structural Protein NS1.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
P31 R38 A42 G45 R46 T49
Binding residue
(residue number reindexed from 1)
P31 R38 A42 G45 R46 T49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6zlc, PDBe:6zlc, PDBj:6zlc
PDBsum6zlc
PubMed32867106
UniProtQ1PST0

[Back to BioLiP]