Structure of PDB 6zix Chain B Binding Site BS01

Receptor Information
>6zix Chain B (length=205) Species: 90371 (Salmonella enterica subsp. enterica serovar Typhimurium) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NNMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAH
VLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDL
DIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSRLLEKISAGDKRLSPK
ESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNY
LSSVT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zix Structure-based analyses of Salmonella RcsB variants unravel new features of the Rcs regulon.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		S152 K154 R177 K180 T181 S184 Q185
Binding residue
(residue number reindexed from 1)		S148 K150 R173 K176 T177 S180 Q181
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6zix, PDBe:6zix, PDBj:6zix
PDBsum6zix
PubMed33638994
UniProtP58663|RCSB_SALTY Transcriptional regulatory protein RcsB (Gene Name=rcsB)

[Back to BioLiP]