Structure of PDB 6z00 Chain B Binding Site BS01

Receptor Information

>6z00 Chain B (length=151) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VSVSLDGVRDKNLMQLKILNTVLFPVRYNDKYYADAIAAGEFTKLAYYND
ICVGAIACRLEKKESGAMRVYIMTLGVLAPYRGIGIGSNLLNHVLDMCSK
QNMCEIYLHVQTNNEDAIKFYKKFGFEITDTIQNYYINIEPRDCYVVSKS
F

Ligand information

>6z00 Chain D (length=5) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

MVNAL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6z00 Structural and functional characterization of the N-terminal acetyltransferase Naa50.
Resolution	1.42 Å
Binding residue (original residue number in PDB)	F30 V32 Y34 M79 Y141 Y142
Binding residue (residue number reindexed from 1)	F24 V26 Y28 M73 Y135 Y136

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004596	peptide alpha-N-acetyltransferase activity
GO:0005515	protein binding
GO:0016746	acyltransferase activity
GO:0016747	acyltransferase activity, transferring groups other than amino-acyl groups

	Biological Process
GO:0008219	cell death
GO:0034976	response to endoplasmic reticulum stress
GO:0048364	root development
GO:0090351	seedling development

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6z00, PDBe:6z00, PDBj:6z00
PDBsum	6z00
PubMed	33400917
UniProt	Q9LFM3

[Back to BioLiP]