Structure of PDB 6yxk Chain B Binding Site BS01

Receptor Information
>6yxk Chain B (length=218) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIEMTQYPDSLAVFLGERATVNCKSSQSVLHWGNDKNYFAWYQQKRGQAP
KLLISSSSARESGVPDRFSGSGSGTDFNLTISSLQAEDVAVYFCQQYYEA
PYTFGQGTRLEIKTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK
VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE
VTHQGLSSPVTKSFNRGC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6yxk Surface Ig variable domain glycosylation affects autoantigen binding and acts as threshold for human autoreactive B cell activation.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		H31 W32 G33 N34 Y38 Y98 Y102
Binding residue
(residue number reindexed from 1)		H31 W32 G33 N34 Y38 Y98 Y102
External links