Structure of PDB 6xyx Chain B Binding Site BS01

Receptor Information
>6xyx Chain B (length=119) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGL
FYSIFTDQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMAVM
ATAMYLQMEHVVDTCRKFI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xyx Functionalization of the BCL6 BTB domain into a noncovalent crystallization chaperone.
Resolution1.44 Å
Binding residue
(original residue number in PDB)
S7 Q8 I9 Q10 F11 T12 R13 H14 D17 V18 N21 R24 R28
Binding residue
(residue number reindexed from 1)
S1 Q2 I3 Q4 F5 T6 R7 H8 D11 V12 N15 R18 R22
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6xyx, PDBe:6xyx, PDBj:6xyx
PDBsum6xyx
PubMed33708392
UniProtP41182|BCL6_HUMAN B-cell lymphoma 6 protein (Gene Name=BCL6)

[Back to BioLiP]