Structure of PDB 6xxr Chain B Binding Site BS01

Receptor Information
>6xxr Chain B (length=108) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKI
QDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASA
MMHALEVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xxr Designed nanomolar small-molecule inhibitors of Ena/VASP EVH1 interaction impair invasion and extravasation of breast cancer cells.
Resolution1.48 Å
Binding residue
(original residue number in PDB)
Y16 W23 K69 N71 F77 Q79 R81 V86
Binding residue
(residue number reindexed from 1)
Y13 W20 K66 N68 F74 Q76 R78 V83
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6xxr, PDBe:6xxr, PDBj:6xxr
PDBsum6xxr
PubMed33184177
UniProtQ8N8S7|ENAH_HUMAN Protein enabled homolog (Gene Name=ENAH)

[Back to BioLiP]